Welcome to LookChem.com Sign In|Join Free
The company logo of weifang yangxu group co.,ltd

weifang yangxu group co.,ltd

Diamond Supplier Enterprise Certification

Diamond
Supplier
1st
years

weifang yangxu group co.,ltd

Business Type:Lab/Research institutions

Audited Supplier

Main Products:
chemical.enzyme.peptide.and so on
Year Established:
2025
Home>>Products>>AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2

Product Certification&
Enterprise Certification

More Detail

weifang yangxu group co.,ltd

Country: China (Mainland)

Business Type:Lab/Research institutions

Mr.peterlee

Tel: +08613666361637--

Mobile: 13666361637

Tel: +08613666361637--

Fax:

URL: https://www.wfyangxu.com/

Province/state: shandong

City: weifang

Street: No 5.dongfeng east street.gaoxin district.weifang city.

MaxCard:


Contact Suppliers

AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2

CAS NO.475221-20-6

  • FOB Price: USD: 10.00-10.00 /Kilogram Get Latest Price
  • Min.Order: 1 Milligram
  • Payment Terms: L/C,D/A,D/P,T/T,Other
  • Available Specifications:

    99.9(1-100)Kilogram

Contact Supplier

Product Details

Keywords

  • AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2
  • C206H324N56O65
  • 475221-20-6

Quick Details

  • ProName: AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQ...
  • CasNo: 475221-20-6
  • Molecular Formula: C206H324N56O65
  • Application: AC-RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQ...
  • DeliveryTime: 7days after your payment
  • PackAge: box or opp package
  • Port: qingdao
  • ProductionCapacity: 100000000 Kilogram/Month
  • Purity: 99%
  • Storage: cool drum
  • Transportation: air or sea
  • LimitNum: 1 Milligram

Superiority

 

Q1:Are you manufacturer or trading company?
A1: Manufacturer.
Q2: Can I get some sample?
A2: Yes
Q3: What's your MOQ?
A3: Our MOQ is flexible.different price for different quantity
Q4: Is there a discount?
A4: Of course, welcome to contact us. Price would be different based on different quantity. For bulk quantity,we will have discount for you.
Q5: How long for production and delivery?
A5: Most products we have in stock, delivery time:Within 1-3 business days after received payment. Customized products further discussed.
Q6: How to deliver the goods?
A6: ≤50kg ship by FedEx or DHL etc, ≥50kg ship by Air, ≥100kg can be shipped by Sea. If you have special request on delivery, please contact us.
Q7:What is the shelf life for the products?
A7: Most products shelf life 24-36 months, meet with COA.
Q8: Do you accept ODM or OEM service?
A8: Yes,we accept ODM and OEM services, ranges: Soft gel, Capsule, Tablet, Sachet, Granule, Private Label service, etc.Please contact us to design your own brand product.
Q9: How to start orders or make payments?
Proforma invoice with our company bank details will be sent to you once the order confirmed by Email. Pls arrange payment by TT.paypal.and so on. Goods will be sent after received payment within 1-3 business days.

Details

package choice 

our factory

shipping choice

good feedback from other buyers.

WEIFANG YANGXU GROUP Co., Ltd was founded in 1996. More than 20 years full efforts, YANGXU chemical has grown to be a large enzyme peptide chemical enterprise, specializing in exploring, researching, manufacturing and marketing of industrial food chemical. We have 1 strain R & D center, 1 application research center and 2 modern manufacturing bases. Yangxu group is the member of China Biotech Fermentation Industry Association, and has been awarded as "Key Enterprise of China CHEMICAL Industry". Currently, YANGXU group has established 6 subsidiary companies and 30 offices in 32 cities, provinces and municipalities in China. Our products have been exported to more than 30 countries and regions. "YangXu" has become a leading brand of chemical industry in China. No matter small order or big order. We always serve you in a good service. Customers is our god. We will try our best to help you and help us to get a long business cooperation. We receive ODM. OEM. AND SO ON. We can develop any hard products too for future business.